Newer posts are loading.
You are at the newest post.
Click here to check if anything new just came in.

May 13 2009

Inte
Capslocker
This device plugs into a USB port and implements a USB HID keyboard. Instead of doing anything useful, it waits between 30 seconds and 8 minutes and sends the scancode for the Caps Lock key. This will toggle the Caps Lock status on or off. Since the operating system controls the LED on the keyboard, the Caps Lock light also toggles. This makes it appear the user has accidentally pressed the Caps Lock key...until it happens 20 or 30 times and they get suspicious. Then they might see the Caps Lock light turn on by itself. Next is a sequence of reboots, bashing the keyboard on the desk, clicking through the Control Panel, possibly even replacing the keyboard. Unless they notice the tiny little device sitting in one of the USB ports on the back of their computer, nothing will help.
Reposted bydeinneuerfreundhothoufbognerbenemoonsterZaphodBskullbockswampeEineFragevonStilderschlaeferLeJacquesdatenwolffaselkrannixmechanicaldeinneuerfreundsplitbrainsguWherezMyDolphinyetztb-whanneszenediktEineFragevonStilreturn13Hoazlfoe05prgtomashhaberablekeliasacidhappymealtavewishlisttowoDerOrwischerschlumpi661fpletzbbdgammagoblinZaphodBnibblernutztookFreXxXbigbear3001peritusbibabutzemannNorkNorkstarbugfooselmaexast47lofiyogancliffordcheathaSixtusAndisuppenkasperlgemueseneingeistbtwotchdragonchaserjaphyleafnodeshw84625lgeo404bananaapplezsgiantspacehamsteramelievroomsciphexpenpensstefaniahappymealharadayvoisardfnk4NorkNorkivylleonelleablKryptoniteKoojavfhrViikeduartenFeichtiMalcolmfairyoknoLuftytwoviperFreXxXlesezeitskizzochristoph-modertaw